- FAM26E Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-91162
- C6orf188, FAM26E, dJ493F7.3
- Rabbit
- 0.1 ml (also 25ul)
- PBS (pH 7.2) and 40% Glycerol
- Unconjugated
- Immunohistochemistry, Immunohistochemistry-Paraffin
- This antibody was developed against Recombinant Protein corresponding to amino acids: YECAMSGTRS SGLLELICKG KPKECWEELH KVSCGKTSML PTVNEELKLS LQA
- Human
- FAM26E
- calcium homeostasis modulator family member 5
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
YECAMSGTRSSGLLELICKGKPKECWEELHKVSCGKTSMLPTVNEELKLSLQA
Specifications/Features
Available conjugates: Unconjugated